Moonbase
← Back to Awards
NATIONAL HEART, LUNG, AND BLOOD INSTITUTENIH · NATIONAL HEART, LUNG, AND BLOOD INSTITUTENIH

Mechanical signaling through the nuclear membrane in lung alveolar health

Morrisey, Edward E (Contact)·University of Pennsylvania, PA·2023–2027·ACTIVE
Donate

INSTITUTION

University of Pennsylvania, PA

PRINCIPAL INVESTIGATOR

Morrisey, Edward E (Contact)

FUNDING

$791K

YEAR

2023

MOONBASE SCORE

Still being scored

LOADING MOONBASE SCORE

Abstract

PROJECT SUMMARY The mammalian respiratory system undergoes cyclical mechanical strain as part of its normal function. Lungs have evolved to be flexible to adapt to this strain, which involves rhythmic inflation and deflation of the alveoli for efficient gas exchange. Multiple cell lineages comprise the alveolar niche including alveolar type 1 (AT1) and alveolar type 2 (AT2) epithelial cells as well as various unique mesenchymal and endothelial cell types. AT1 cells are required for efficient gas exchange across the endothelial capillary plexus while AT2 cells generate pulmonary surfactant and act as facultative progenitors that differentiate into AT1 cells. While most studies on mechanotransduction have focused on the response of mesenchymal lineages, the ability of epithelial cells, in particular those within the lung alveoli, to respond to and maintain their identity and function in the face of this continuous and rhythmic biomechanical strain has not been well defined. Using multiple genetic and biophysical approaches, we present new preliminary data demonstrating that loss of cytoskeletal-extracellular matrix interactions via genetic, mechanical and chemical perturbations in AT1cells, leads to their rapid reprogramming into AT2 cells in vivo. Single cell RNA-seq (scRNA-seq) analysis shows that these reprogrammed AT2 cells are very similar to normal AT2 cells. Loss of AT1 cell fate is accompanied by coordinate changes in lamina- associated chromatin domain (LAD) organization, causing sequestration or release of AT1 or AT2 specific loci located in LAD sat the nuclear periphery. This phenomenon inversely correlates to the changes in alveolar epithelial cell fate. Importantly, we have developed a novel model of unilateral mechanical unloading of the cyclical strain from breathing movements in the lungs and show that this causes a profound reprogramming of AT1 into AT2 cells. In agreement with these new Preliminary Data, our laboratories recently demonstrated that Yap/Taz are found in the nucleus of AT1, but not AT2cells, and are essential for maintaining AT1 cell fate throughout the lifespan of mice. Loss of Yap/Taz results in a rapid reprogramming of AT1 cells into AT2 cells in the absence of injury. Since Yap/Taz can function as cytoplasmic mechanotransducers in cells and translocate to the nucleus upon actin-regulated cell stretch and strain, our combined preliminary and published data suggest that mechanotransduction plays a specific role in AT1cells to maintain alveolar function in the homeostatic lung. Thus, our published and preliminary data raise a provocative hypothesis that the lung has evolved specific epigenetic and transcriptional mechanisms to maintain cellular fate in the face of mechanical strain from normal respiration and these pathways are altered in the response to injury and disease. This proposal brings together two complementary laboratories with extensive experience in the study of lung development, epigenetic control of cell fate, and the inherent implications for regeneration and disease and we aim to address key unanswered questions in cell fate regulation in lung development and regeneration.

NATIONAL HEART, LUNG, AND BLOOD INSTITUTER01Lung Injury, Repair, and Remodeling Study Section[LIRR]typespathwayschemicalefficientdomainmechanicalleadsorganizationpresentcapillarymesenchymaltranscriptionalsummarysfdrequiredgeneticdiseasequestionspulmonaryplexus

Are you the primary organization running this research?

The two tools below are built for the principal investigator & host institution behind this project.